PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_28560-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 157aa    MW: 17305.6 Da    PI: 5.2141
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_28560-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH29.81e-096998231
                     HHHHHHHHHHHHHHHHHHHHHHHCTSCCC. CS
              HLH  2 rrahnerErrRRdriNsafeeLrellPkas 31
                     rr+h ++Er+RR+++N+ ++ Lr+ +P+++
  TRIUR3_28560-P1 69 RRNHIAVERNRRRQMNDYLAVLRSSMPPSY 98
                     999************************973 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474594.36E-867100IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.78567126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.3E-86898IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.68E-769101No hitNo description
PfamPF000103.9E-76997IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MALEAVVFPH EHLACSTDKV AAAMSMYAPS LGRGISIVDE FEEKGGVVLQ EEAANYAWAA  60
AVEGNWDERR NHIAVERNRR RQMNDYLAVL RSSMPPSYAQ RCLGLTVLHL NATATADHLV  120
FYSFSLRMED ECRLSTVDEI AAAVHQMVAE VHAGGPC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16979RNHIAVERNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688739.14e-53PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH57-like
TrEMBLM7ZT481e-114M7ZT48_TRIUA; Transcription factor bHLH96
STRINGOB02G40170.18e-26(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104622843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72210.15e-13bHLH family protein